PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03962.1.g00120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family VOZ
Protein Properties Length: 133aa    MW: 15678.4 Da    PI: 5.8083
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03962.1.g00120.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ2243.7e-6922132102212
                           VOZ 102 egetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalal 182
                                   +ge+irewlffdkprraf+sgnrkqrslpdy grgwhesrkqvmk+fgglkrsyymdpqpsss+ewhlyeyein++da+al
  Zmw_sc03962.1.g00120.1.sm.mk  22 QGESIREWLFFDKPRRAFDSGNRKQRSLPDYGGRGWHESRKQVMKDFGGLKRSYYMDPQPSSSYEWHLYEYEINDCDAFAL 102
                                   69******************************************************************************* PP

                           VOZ 183 yrlelklvdekksakgkvskdsladlqkkl 212
                                   yrle+k++d+kksak+k++++sl+++q+++
  Zmw_sc03962.1.g00120.1.sm.mk 103 YRLEFKSSDAKKSAKSKLACNSLNEIQQQM 132
                                   *****************************9 PP

Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MAQGFEFCPE YQTLPWTGEG DQGESIREWL FFDKPRRAFD SGNRKQRSLP DYGGRGWHES  60
RKQVMKDFGG LKRSYYMDPQ PSSSYEWHLY EYEINDCDAF ALYRLEFKSS DAKKSAKSKL  120
ACNSLNEIQQ QME
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569827.15e-73PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ04e-55VOZ1_ARATH; Transcription factor VOZ1
TrEMBLI1HRM95e-73I1HRM9_BRADI; Uncharacterized protein
TrEMBLQ0JJ943e-74Q0JJ94_ORYSJ; Os01g0753000 protein (Fragment)
STRINGBRADI2G50070.11e-72(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888